Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CKAP2 Peptide - C-terminal region

CKAP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp686L1238, FLJ10749, LB1, TMAP, se20-10

UniProt

Q8WWK9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CKAP2 Rabbit Polyclonal Antibody (orb585164) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001091995

Preservative

Lyophilized powder

AA Sequence

GKAIVDSRSAQPKETSEERKARLSEWKAGKGRVLKRPPNSVVTQHEPAGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPP2 (MAGUK p55 Subfamily Member 2, Discs Large Homolog 2, Protein MPP2, DLG2) (HRP)
MBS6385801-01 0.1 mL

MPP2 (MAGUK p55 Subfamily Member 2, Discs Large Homolog 2, Protein MPP2, DLG2) (HRP)

Sign In for Pricing
View Details
MPP2 (MAGUK p55 Subfamily Member 2, Discs Large Homolog 2, Protein MPP2, DLG2) (HRP)
MBS6385801-02 5x 0.1 mL

MPP2 (MAGUK p55 Subfamily Member 2, Discs Large Homolog 2, Protein MPP2, DLG2) (HRP)

Sign In for Pricing
View Details
Lentiviral human RPS6KA5 shRNA (UAS) - Lentiviral human RPS6KA5 shRNA (UAS, GFP) plasmid
GTR15135094 1 Vial

Lentiviral human RPS6KA5 shRNA (UAS) - Lentiviral human RPS6KA5 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Cd24a Protein Vector (Mouse) (pPM-C-His)
PV163313 500 ng

Cd24a Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
SDCBP Antibody
MBS7126434-01 0.05 mL

SDCBP Antibody

Sign In for Pricing
View Details
SDCBP Antibody
MBS7126434-02 0.1 mL

SDCBP Antibody

Sign In for Pricing
View Details