Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CKAP2 Peptide - C-terminal region

CKAP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp686L1238, FLJ10749, LB1, TMAP, se20-10

UniProt

Q8WWK9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CKAP2 Rabbit Polyclonal Antibody (orb585164) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001091995

Preservative

Lyophilized powder

AA Sequence

GKAIVDSRSAQPKETSEERKARLSEWKAGKGRVLKRPPNSVVTQHEPAGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pack of 100 folded technical filter 160g/m², 330 mm
FT107P0330 Pack of 100

Pack of 100 folded technical filter 160g/m², 330 mm

Sign In for Pricing
View Details
FAM103A1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0739405 3x 1.0 µg

FAM103A1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Tyrosine-protein phosphatase non-receptor type 1
AP87517 1 mg

Tyrosine-protein phosphatase non-receptor type 1

Sign In for Pricing
View Details
MIR8103 Mouse qPCR Template Standard (MI0026033)
MK301182 200 Reactions

MIR8103 Mouse qPCR Template Standard (MI0026033)

Sign In for Pricing
View Details
PSMB9 ELISA Kit (Human) (OKEH04653)
OKEH04653 96 Well

PSMB9 ELISA Kit (Human) (OKEH04653)

Sign In for Pricing
View Details
Rabbit Anti-Donkey IgG (H&L) FITC
DL87079A-01 100 µL

Rabbit Anti-Donkey IgG (H&L) FITC

Sign In for Pricing
View Details