Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clcn1 Peptide - C-terminal region

Clcn1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SMCC, Clcn1

UniProt

P35524

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Clcn1 Rabbit Polyclonal Antibody (orb575316) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037279

Preservative

Lyophilized powder

AA Sequence

SSIFQRLLHCLLGKAHSTKKKITQDSTDLVDNMSPEEIEAWEREQLSQPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bmp10 Antibody (N-term)
orb1934324-01 50 µL

Bmp10 Antibody (N-term)

Sign In for Pricing
View Details
Bmp10 Antibody (N-term)
orb1934324-02 100 µL

Bmp10 Antibody (N-term)

Sign In for Pricing
View Details
UGDH antibody
70R-21153 50 μL

UGDH antibody

Sign In for Pricing
View Details
Goat IgG (H&L) Antibody F (ab') 2 - Biotin Conjugated
OARA04060-500UG 500 µg

Goat IgG (H&L) Antibody F (ab') 2 - Biotin Conjugated

Sign In for Pricing
View Details
10- (4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl) -7H-benzo[c]carbazole
OR1034577-01 50 mg

10- (4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl) -7H-benzo[c]carbazole

Sign In for Pricing
View Details
10- (4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl) -7H-benzo[c]carbazole
OR1034577-02 100 mg

10- (4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl) -7H-benzo[c]carbazole

Sign In for Pricing
View Details