Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clcn1 Peptide - C-terminal region

Clcn1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SMCC, Clcn1

UniProt

P35524

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Clcn1 Rabbit Polyclonal Antibody (orb575316) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037279

Preservative

Lyophilized powder

AA Sequence

SSIFQRLLHCLLGKAHSTKKKITQDSTDLVDNMSPEEIEAWEREQLSQPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Apc10 Antibody (8F1D10)
NBP2-61889-0.025mL 0.025 mL

Mouse Monoclonal Apc10 Antibody (8F1D10)

Sign In for Pricing
View Details
Rat Alpha-2C adrenergic receptor (ADRA2C) ELISA Kit
AE24094RA-01 48 Tests

Rat Alpha-2C adrenergic receptor (ADRA2C) ELISA Kit

Sign In for Pricing
View Details
Rat Alpha-2C adrenergic receptor (ADRA2C) ELISA Kit
AE24094RA-02 96 Tests

Rat Alpha-2C adrenergic receptor (ADRA2C) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal SYNPO2 Antibody [Alexa Fluor 750]
NBP2-82037AF750 0.1 mL

Rabbit Polyclonal SYNPO2 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
CRFK Luciferase Reporter Cell Line
ABC-RC073H 1 Vial

CRFK Luciferase Reporter Cell Line

Sign In for Pricing
View Details
ENDOG CRISPR Activation Plasmid (m)
sc-420176-ACT 20 µg

ENDOG CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details