Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clcn5 Peptide - middle region

Clcn5 Peptide - middle region

Product Specifications

Product Name Alternative

5430408K11Rik, ClC-5, Clc5, D930009B12Rik, DXImx42e, Sfc13, T25545

UniProt

Q9WVD4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Clcn5 Rabbit Polyclonal Antibody (orb575317) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057900

Preservative

Lyophilized powder

AA Sequence

LVVIMFELTGGLEYIVPLMAAAMTSKWVADALGREGIYDAHIRLNGYPFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Galectin 3 Monoclonal Antibody
E-AB-81559-01 50 µL

Recombinant Galectin 3 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Galectin 3 Monoclonal Antibody
E-AB-81559-02 100 µL

Recombinant Galectin 3 Monoclonal Antibody

Sign In for Pricing
View Details
Purified Anti-Human CD11b Antibody[ICRF44]
E-AB-F11460P-01 25 µg

Purified Anti-Human CD11b Antibody[ICRF44]

Sign In for Pricing
View Details
Purified Anti-Human CD11b Antibody[ICRF44]
E-AB-F11460P-02 100 µg

Purified Anti-Human CD11b Antibody[ICRF44]

Sign In for Pricing
View Details
Recombinant Human Neurotensin Protein (Fc Tag)
PKSH030549 100 µg

Recombinant Human Neurotensin Protein (Fc Tag)

Sign In for Pricing
View Details
O,O-Diethyl Thiophosphate Sodium Salt
TRC-D445125-250MG 250 mg

O,O-Diethyl Thiophosphate Sodium Salt

Sign In for Pricing
View Details