Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clcn5 Peptide - middle region

Clcn5 Peptide - middle region

Product Specifications

Product Name Alternative

5430408K11Rik, ClC-5, Clc5, D930009B12Rik, DXImx42e, Sfc13, T25545

UniProt

Q9WVD4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Clcn5 Rabbit Polyclonal Antibody (orb575317) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057900

Preservative

Lyophilized powder

AA Sequence

LVVIMFELTGGLEYIVPLMAAAMTSKWVADALGREGIYDAHIRLNGYPFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Naphthylacetic Acid 4-Nitrophenyl Ester
TRC-N377770-250MG 250 mg

1-Naphthylacetic Acid 4-Nitrophenyl Ester

Sign In for Pricing
View Details
TBL1 (TBL1X) Human Gene Knockout Kit (CRISPR)
KN213516RB 1 Kit

TBL1 (TBL1X) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
rel-(2R,3R)-6-[Alpha-(2-Ethoxyphenoxy)benzyl]morpholin-3-one
TRC-E892650-5MG 5 mg

rel-(2R,3R)-6-[Alpha-(2-Ethoxyphenoxy)benzyl]morpholin-3-one

Sign In for Pricing
View Details
Human DLL1 Antibody Pair Set
E-KAB-0420 50 µL & 100 µg

Human DLL1 Antibody Pair Set

Sign In for Pricing
View Details
HRH1 Rabbit Polyclonal Antibody
AP01271PU-N 100 µg

HRH1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IL2 Receptor alpha (IL2RA) Mouse Monoclonal Antibody [Clone ID: B-F2]
AM31170AF-N 200 µg

IL2 Receptor alpha (IL2RA) Mouse Monoclonal Antibody [Clone ID: B-F2]

Sign In for Pricing
View Details