Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC4M Peptide - middle region

CLEC4M Peptide - middle region

Product Specifications

Product Name Alternative

CD209L, CD299, DC-SIGN2, DC-SIGNR, DCSIGNR, HP10347, L-SIGN, LSIGN, MGC129964, MGC47866

UniProt

Q9H2X3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLEC4M Rabbit Polyclonal Antibody (orb325006) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055072

Preservative

Lyophilized powder

AA Sequence

NRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant CD3E Antibody
RC-4262-01 50 μL

Recombinant CD3E Antibody

Sign In for Pricing
View Details
Recombinant CD3E Antibody
RC-4262-02 100 µL

Recombinant CD3E Antibody

Sign In for Pricing
View Details
Recombinant CD3E Antibody
RC-4262-03 1 mL

Recombinant CD3E Antibody

Sign In for Pricing
View Details
Camta2 Mouse Gene Knockout Kit (CRISPR)
KN502494 1 Kit

Camta2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Albumin (BCP) Microplate Assay Kit
RDSM140 100 Assays

Albumin (BCP) Microplate Assay Kit

Sign In for Pricing
View Details
KLK4 Polyclonal Antibody
E-AB-14180-01 20 µL

KLK4 Polyclonal Antibody

Sign In for Pricing
View Details