Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC4M Peptide - middle region

CLEC4M Peptide - middle region

Product Specifications

Product Name Alternative

CD209L, CD299, DC-SIGN2, DC-SIGNR, DCSIGNR, HP10347, L-SIGN, LSIGN, MGC129964, MGC47866

UniProt

Q9H2X3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLEC4M Rabbit Polyclonal Antibody (orb325006) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055072

Preservative

Lyophilized powder

AA Sequence

NRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRCA1 (Breast Marker) (BRCA1/1472), CF740 conjugate, 0.1mg/mL
BNC741472-100 1x 100 µL

BRCA1 (Breast Marker) (BRCA1/1472), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RAI14 (NM_015577) Human Over-expression Lysate
LC402452 20 µg

RAI14 (NM_015577) Human Over-expression Lysate

Sign In for Pricing
View Details
Muscarinic Acetylcholine Receptor M3 (CHRM3) (3rd Cytopl. Dom.) Rabbit Polyclonal Antibody
AP06825PU-N 50 µg

Muscarinic Acetylcholine Receptor M3 (CHRM3) (3rd Cytopl. Dom.) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Idoxifene
TRC-I654050-50MG 50 mg

Idoxifene

Sign In for Pricing
View Details
5-Amino-1-phenylpyrazole-4-carboxamide
TRC-A626225-2G 2 g

5-Amino-1-phenylpyrazole-4-carboxamide

Sign In for Pricing
View Details
Rhod-5N, tripotassium salt
21072-AAT 1 mg

Rhod-5N, tripotassium salt

Sign In for Pricing
View Details