Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLIC3 Peptide - N-terminal region

CLIC3 Peptide - N-terminal region

Product Specifications

UniProt

O95833

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLIC3 Rabbit Polyclonal Antibody (orb329814) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004660

Preservative

Lyophilized powder

AA Sequence

LTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD207 Recombinant Protein
PPT-11294 100 µg

Human CD207 Recombinant Protein

Sign In for Pricing
View Details
Lentiviral human PTCRA sgRNA gene knockout kit - Lentiviral human PTCRA sgRNA gene knockout kit (100)
GTR15354318 1 Vial

Lentiviral human PTCRA sgRNA gene knockout kit - Lentiviral human PTCRA sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
FKBP9 Recombinant Protein (Mouse)
RP134753 100 µg

FKBP9 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
TMCC3 (NM_020698) Human Over-expression Lysate
LS057458 100 µg

TMCC3 (NM_020698) Human Over-expression Lysate

Sign In for Pricing
View Details
Human PAPOLA (NM_001293627) AAV Particle
RC239460A1V 250 µL

Human PAPOLA (NM_001293627) AAV Particle

Sign In for Pricing
View Details
AQP1 Antibody
A46280-100UG 100 µg

AQP1 Antibody

Sign In for Pricing
View Details