Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLIC3 Peptide - N-terminal region

CLIC3 Peptide - N-terminal region

Product Specifications

UniProt

O95833

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLIC3 Rabbit Polyclonal Antibody (orb329814) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004660

Preservative

Lyophilized powder

AA Sequence

LTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2'-O-4'-C-Locked-rC (Bz)
HY-178600 1 Each

2'-O-4'-C-Locked-rC (Bz)

Sign In for Pricing
View Details
Apcdd1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4313807 1.0 µg DNA

Apcdd1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Type III iodothyronine deiodinase (dio3), partial
MBS1172052-01 0.05 mg (E-Coli)

Recombinant Xenopus laevis Type III iodothyronine deiodinase (dio3), partial

Sign In for Pricing
View Details
Recombinant Xenopus laevis Type III iodothyronine deiodinase (dio3), partial
MBS1172052-02 0.05 mg (Yeast)

Recombinant Xenopus laevis Type III iodothyronine deiodinase (dio3), partial

Sign In for Pricing
View Details
Recombinant Xenopus laevis Type III iodothyronine deiodinase (dio3), partial
MBS1172052-03 0.2 mg (E-Coli)

Recombinant Xenopus laevis Type III iodothyronine deiodinase (dio3), partial

Sign In for Pricing
View Details
Recombinant Xenopus laevis Type III iodothyronine deiodinase (dio3), partial
MBS1172052-04 0.05 mg (Baculovirus)

Recombinant Xenopus laevis Type III iodothyronine deiodinase (dio3), partial

Sign In for Pricing
View Details