Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clip3 Peptide - N-terminal region

Clip3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1500005P14Rik, AI844915, Clipr-59

UniProt

B9EHT4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Clip3 Rabbit Polyclonal Antibody (orb582690) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001074583

Preservative

Lyophilized powder

AA Sequence

MAPPPRGEEEEEEEEDEPVPEAPSPTQERRQKPVVHPSAPAPLPKDYAFT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DYRK3 Human qPCR Primer Pair (NM_003582)
HP225794 200 Reactions

DYRK3 Human qPCR Primer Pair (NM_003582)

Sign In for Pricing
View Details
PON1 (NM_000446) Human Recombinant Protein
TP310356SE 20 µg

PON1 (NM_000446) Human Recombinant Protein

Sign In for Pricing
View Details
17Alpha-Trenbolone
TRC-T718990-2.5MG 2.5 mg

17Alpha-Trenbolone

Sign In for Pricing
View Details
Human EFCAB1 activation kit by CRISPRa
GA112514 1 Kit

Human EFCAB1 activation kit by CRISPRa

Sign In for Pricing
View Details
Human LOC100130370 activation kit by CRISPRa
GA119120 1 Kit

Human LOC100130370 activation kit by CRISPRa

Sign In for Pricing
View Details
Claudin 8 (CLDN8) (Center) Rabbit Polyclonal Antibody
AP50952PU-N 400 µL

Claudin 8 (CLDN8) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details