Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clip3 Peptide - N-terminal region

Clip3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1500005P14Rik, AI844915, Clipr-59

UniProt

B9EHT4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Clip3 Rabbit Polyclonal Antibody (orb582690) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001074583

Preservative

Lyophilized powder

AA Sequence

MAPPPRGEEEEEEEEDEPVPEAPSPTQERRQKPVVHPSAPAPLPKDYAFT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mrpl42 (NM_026065) Mouse Tagged ORF Clone
MG200919 10 µg

Mrpl42 (NM_026065) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Anti-Human IgG3 Antibody
KC-087-01 50 μL

Anti-Human IgG3 Antibody

Sign In for Pricing
View Details
Anti-Human IgG3 Antibody
KC-087-02 100 µL

Anti-Human IgG3 Antibody

Sign In for Pricing
View Details
Anti-Human IgG3 Antibody
KC-087-03 1 mL

Anti-Human IgG3 Antibody

Sign In for Pricing
View Details
CD79a Mouse Monoclonal Antibody [C1-E8]
EM1902-29 100 µL

CD79a Mouse Monoclonal Antibody [C1-E8]

Sign In for Pricing
View Details
2-Azidoethyl 2-Acetamido-2-deoxy-b-D-glucopyranoside
TRC-A848995-50MG 50 mg

2-Azidoethyl 2-Acetamido-2-deoxy-b-D-glucopyranoside

Sign In for Pricing
View Details