Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clns1a Peptide - C-terminal region

Clns1a Peptide - C-terminal region

Product Specifications

Product Name Alternative

2610036D06Rik, 2610100O04Rik, Clci, Clcni, ICLN

UniProt

Q923F1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Clns1a Rabbit Polyclonal Antibody (orb581505) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076160

Preservative

Lyophilized powder

AA Sequence

ALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Desmosteryl Sulfate Sodium Salt
TRC-D432502-10MG 10 mg

Desmosteryl Sulfate Sodium Salt

Sign In for Pricing
View Details
Rabbit Polyclonal AIFM3 Antibody [Alexa Fluor 700]
NBP1-76378AF700 0.1 mL

Rabbit Polyclonal AIFM3 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
RPL23P6 ORF Vector (Human) (pORF)
41219011 1.0 µg DNA

RPL23P6 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
TUBB4 Protein Vector (Human) (pPM-C-HA)
PV044611 500 ng

TUBB4 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
PCAF Rabbit Polyclonal Antibody
orb556629 100 µL

PCAF Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TBC1D9B Protein Lysate
OCOA10836-20UG 20 µg

TBC1D9B Protein Lysate

Sign In for Pricing
View Details