Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clns1a Peptide - C-terminal region

Clns1a Peptide - C-terminal region

Product Specifications

Product Name Alternative

2610036D06Rik, 2610100O04Rik, Clci, Clcni, ICLN

UniProt

Q923F1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Clns1a Rabbit Polyclonal Antibody (orb581505) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076160

Preservative

Lyophilized powder

AA Sequence

ALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CIDEC Antibody
MBS8517924-01 0.05 mg

CIDEC Antibody

Sign In for Pricing
View Details
CIDEC Antibody
MBS8517924-02 0.1 mg

CIDEC Antibody

Sign In for Pricing
View Details
CIDEC Antibody
MBS8517924-03 0.1 mL (AF750)

CIDEC Antibody

Sign In for Pricing
View Details
CIDEC Antibody
MBS8517924-04 0.1 mL (AF405M)

CIDEC Antibody

Sign In for Pricing
View Details
CIDEC Antibody
MBS8517924-05 0.1 mL (AF546)

CIDEC Antibody

Sign In for Pricing
View Details
CIDEC Antibody
MBS8517924-06 0.1 mL (AF405L)

CIDEC Antibody

Sign In for Pricing
View Details