Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLPX Peptide - C-terminal region

CLPX Peptide - C-terminal region

Product Specifications

UniProt

O76031

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLPX Rabbit Polyclonal Antibody (orb585642) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006651

Preservative

Lyophilized powder

AA Sequence

MFEVPNSDIVCVEVDKEVVEGKKEPGYIRAPTKESSEEEYDSGVEEEGWP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTSW CRISPR All-in-one AAV vector set (with saCas9)(Rat)
17122156 3x 1.0 µg DNA

CTSW CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
VAT1L Rabbit Polyclonal Antibody (Cy5.5)
orb1036769 100 µL

VAT1L Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Human PACAP-38 ELISA Kit (Colorimetric)
NBP3-08165 1 Kit

Human PACAP-38 ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
Canine 5-Aminolevulinic Acid ELISA Kit
MBS7280452-01 48 Well

Canine 5-Aminolevulinic Acid ELISA Kit

Sign In for Pricing
View Details
Canine 5-Aminolevulinic Acid ELISA Kit
MBS7280452-02 96 Well

Canine 5-Aminolevulinic Acid ELISA Kit

Sign In for Pricing
View Details
Canine 5-Aminolevulinic Acid ELISA Kit
MBS7280452-03 5x 96 Well

Canine 5-Aminolevulinic Acid ELISA Kit

Sign In for Pricing
View Details