Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLPX Peptide - C-terminal region

CLPX Peptide - C-terminal region

Product Specifications

UniProt

O76031

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLPX Rabbit Polyclonal Antibody (orb585642) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006651

Preservative

Lyophilized powder

AA Sequence

MFEVPNSDIVCVEVDKEVVEGKKEPGYIRAPTKESSEEEYDSGVEEEGWP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rnf215 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4050308 1.0 µg DNA

Rnf215 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Rabbit SIK2 Antibody
orb1526196-01 10 µL

Rabbit SIK2 Antibody

Sign In for Pricing
View Details
Rabbit SIK2 Antibody
orb1526196-02 100 µL

Rabbit SIK2 Antibody

Sign In for Pricing
View Details
Human Platelet-Activating Factor Acetylhydrolase (PLA2G7) Protein
abx073406-01 5 µg

Human Platelet-Activating Factor Acetylhydrolase (PLA2G7) Protein

Sign In for Pricing
View Details
Human Platelet-Activating Factor Acetylhydrolase (PLA2G7) Protein
abx073406-02 20 µg

Human Platelet-Activating Factor Acetylhydrolase (PLA2G7) Protein

Sign In for Pricing
View Details
Human Platelet-Activating Factor Acetylhydrolase (PLA2G7) Protein
abx073406-03 1 mg

Human Platelet-Activating Factor Acetylhydrolase (PLA2G7) Protein

Sign In for Pricing
View Details