CLSTN1 Peptide - N-terminal region
CLSTN1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CSTN1, FLJ32258, KIAA0911, PIK3CD, XB31alpha, alcalpha1, alcalpha2, CDHR12, ALC-ALPHA
UniProt
O94985
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CLSTN1 Rabbit Polyclonal Antibody (orb579219) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001009566
Preservative
Lyophilized powder
AA Sequence
KPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY422250 100 µg
KIAA1755 (NM_001029864) Human Over-expression Lysate
Sign In for Pricing
View Details 
LY419434 100 µg
KRTHB3 (KRT83) (NM_002282) Human Over-expression Lysate
Sign In for Pricing
View Details ![B7-2 (CD86) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8A7]](https://cdn.genprice.uk/products/937/68dd1b87061270361ea2114d/imageurl/ta813085bm.webp)
TA813085BM 100 µL
B7-2 (CD86) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8A7]
Sign In for Pricing
View Details 
AP50218PU-N 400 µL
APRG1 (C3orf35) (Center) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 