Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLSTN1 Peptide - N-terminal region

CLSTN1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CSTN1, FLJ32258, KIAA0911, PIK3CD, XB31alpha, alcalpha1, alcalpha2, CDHR12, ALC-ALPHA

UniProt

O94985

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLSTN1 Rabbit Polyclonal Antibody (orb579219) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001009566

Preservative

Lyophilized powder

AA Sequence

KPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKR1B1 (NM_001628) Human Over-expression Lysate
LY419838 100 µg

AKR1B1 (NM_001628) Human Over-expression Lysate

Sign In for Pricing
View Details
DMC1 (2H12/4), CF740 conjugate, 0.1mg/mL
BNC742178-100 1x 100 µL

DMC1 (2H12/4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD5 Antibody[53-7.3]
E-AB-F1185UI-01 25 µg

PE/Cyanine5.5 Anti-Mouse CD5 Antibody[53-7.3]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD5 Antibody[53-7.3]
E-AB-F1185UI-02 100 µg

PE/Cyanine5.5 Anti-Mouse CD5 Antibody[53-7.3]

Sign In for Pricing
View Details
C10orf68 (CCDC7) Human qPCR Primer Pair (NM_145023)
HP229495 200 Reactions

C10orf68 (CCDC7) Human qPCR Primer Pair (NM_145023)

Sign In for Pricing
View Details
TRPS1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B2]
TA813179BM 100 µL

TRPS1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B2]

Sign In for Pricing
View Details