Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLSTN3 Peptide - N-terminal region

CLSTN3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CSTN3, KIAA0726, MGC131797, MGC138488, alcbeta, CDHR14

UniProt

Q9BQT9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLSTN3 Rabbit Polyclonal Antibody (orb325310) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055533

Preservative

Lyophilized powder

AA Sequence

QICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Usp13 Mouse Gene Knockout Kit (CRISPR)
KN318768RB 1 Kit

Usp13 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Uncoated Mouse BLC (B-Lymphocyte Chemoattractant) ELISA Kit
E-UNEL-M0053-01 5x 96 Tests

Uncoated Mouse BLC (B-Lymphocyte Chemoattractant) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse BLC (B-Lymphocyte Chemoattractant) ELISA Kit
E-UNEL-M0053-02 15x 96 Tests

Uncoated Mouse BLC (B-Lymphocyte Chemoattractant) ELISA Kit

Sign In for Pricing
View Details
Delta-Tocopherol (>90%)
TRC-T526150-5G 5 g

Delta-Tocopherol (>90%)

Sign In for Pricing
View Details
TNFAIP3 (NM_006290) Human Recombinant Protein
TP321337M 100 µg

TNFAIP3 (NM_006290) Human Recombinant Protein

Sign In for Pricing
View Details
APC Anti-Mouse CD274/PD-L1 Antibody[10F.9G2]
E-AB-F1132UE-01 25 µg

APC Anti-Mouse CD274/PD-L1 Antibody[10F.9G2]

Sign In for Pricing
View Details