CLSTN3 Peptide - N-terminal region
CLSTN3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CSTN3, KIAA0726, MGC131797, MGC138488, alcbeta, CDHR14
UniProt
Q9BQT9
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CLSTN3 Rabbit Polyclonal Antibody (orb325310) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_055533
Preservative
Lyophilized powder
AA Sequence
QICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Thrombospondin 1 Recombinant Rabbit Monoclonal Antibody [PSH02-97]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea8127c/imageurl/ha721916.webp)
HA721916 100 µL
Thrombospondin 1 Recombinant Rabbit Monoclonal Antibody [PSH02-97]
Sign In for Pricing
View Details 
BNC683056-100 1x 100 µL
Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3056), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
#29045-100uL 1x 100 µL
Annexin V, R-phycoerythrin Conjugate (20 assays)
Sign In for Pricing
View Details 