Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLTA Peptide - C-terminal region

CLTA Peptide - C-terminal region

Product Specifications

Product Name Alternative

LCA

UniProt

P09496

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLTA Rabbit Polyclonal Antibody (orb331047) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001824

Preservative

Lyophilized powder

AA Sequence

KELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aromatase (CYP19A1) (NM_000103) Human Over-expression Lysate
LC400031 20 µg

Aromatase (CYP19A1) (NM_000103) Human Over-expression Lysate

Sign In for Pricing
View Details
Adenosine Monophosphate Deaminase 3 (AMPD3) (AMPD3/901), CF405S conjugate, 0.1mg/mL
BNC040901-100 1x 100 µL

Adenosine Monophosphate Deaminase 3 (AMPD3) (AMPD3/901), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD19 Antibody[4G7]
E-AB-F1127H-01 20 Tests

PE/Cyanine7 Anti-Human CD19 Antibody[4G7]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD19 Antibody[4G7]
E-AB-F1127H-02 100 Tests

PE/Cyanine7 Anti-Human CD19 Antibody[4G7]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD19 Antibody[4G7]
E-AB-F1127H-03 2x 100 Tests

PE/Cyanine7 Anti-Human CD19 Antibody[4G7]

Sign In for Pricing
View Details
Human ST6GALNAC6 activation kit by CRISPRa
GA109385 1 Kit

Human ST6GALNAC6 activation kit by CRISPRa

Sign In for Pricing
View Details