Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLTA Peptide - C-terminal region

CLTA Peptide - C-terminal region

Product Specifications

Product Name Alternative

LCA

UniProt

P09496

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLTA Rabbit Polyclonal Antibody (orb331047) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001824

Preservative

Lyophilized powder

AA Sequence

KELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCDC1 Human Gene Knockout Kit (CRISPR)
KN421749 1 Kit

DCDC1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KIRREL3 Antibody
OC-554-01 50 μL

KIRREL3 Antibody

Sign In for Pricing
View Details
KIRREL3 Antibody
OC-554-02 100 µL

KIRREL3 Antibody

Sign In for Pricing
View Details
KIRREL3 Antibody
OC-554-03 1 mL

KIRREL3 Antibody

Sign In for Pricing
View Details
Atp6v1e2 Mouse Gene Knockout Kit (CRISPR)
KN501823 1 Kit

Atp6v1e2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SPRYD5 (TRIM51) (NM_032681) Human Over-expression Lysate
LY432250 100 µg

SPRYD5 (TRIM51) (NM_032681) Human Over-expression Lysate

Sign In for Pricing
View Details