Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLTB Peptide - C-terminal region

CLTB Peptide - C-terminal region

Product Specifications

Product Name Alternative

LCB

UniProt

P09497

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLTB Rabbit Polyclonal Antibody (orb584538) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009028

Preservative

Lyophilized powder

AA Sequence

KLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PACAP (ADCYAP1) (NM_001117) Human Over-expression Lysate
LC400450 20 µg

PACAP (ADCYAP1) (NM_001117) Human Over-expression Lysate

Sign In for Pricing
View Details
CD44v4 (Marker of Tumor Metastasis) (CD44v4/1700R), CF568 conjugate, 0.1mg/mL
BNC681700-100 1x 100 µL

CD44v4 (Marker of Tumor Metastasis) (CD44v4/1700R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Follistatin Like Protein 3 (FSTL3) ELISA Kit
RD-FSTL3-Mu-01 96 Tests

Mouse Follistatin Like Protein 3 (FSTL3) ELISA Kit

Sign In for Pricing
View Details
Mouse Follistatin Like Protein 3 (FSTL3) ELISA Kit
RD-FSTL3-Mu-02 48 Tests

Mouse Follistatin Like Protein 3 (FSTL3) ELISA Kit

Sign In for Pricing
View Details
DAP Antibody
8C12326-AAT 50 µg

DAP Antibody

Sign In for Pricing
View Details
SRPIN340
SIH-514-25MG 25 mg

SRPIN340

Sign In for Pricing
View Details