Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLU Peptide - C-terminal region

CLU Peptide - C-terminal region

Product Specifications

Product Name Alternative

AAG4, APOJ, CLI, KUB1, MGC24903, SGP-2, SGP2, SP-40, TRPM-2, TRPM2, APO-J, NA1/NA2

UniProt

P10909

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLU Rabbit Polyclonal Antibody (orb584908) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001822

Preservative

Lyophilized powder

AA Sequence

CREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PF4 ELISA Kit (Bovine) (OKCD02796)
OKCD02796 96 Well

PF4 ELISA Kit (Bovine) (OKCD02796)

Sign In for Pricing
View Details
ZNF138 Peptide
orb2015176 100 µg

ZNF138 Peptide

Sign In for Pricing
View Details
ASAP3 (NM_017707) Human Untagged Clone
SC113991 10 µg

ASAP3 (NM_017707) Human Untagged Clone

Sign In for Pricing
View Details
TRAM1L1 Protein Lysate (Mouse) with C-HA Tag
47506034 100 µg

TRAM1L1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Chimaerin 2 Antibody
C50234-01 40 µL

Chimaerin 2 Antibody

Sign In for Pricing
View Details
Chimaerin 2 Antibody
C50234-02 100 µL

Chimaerin 2 Antibody

Sign In for Pricing
View Details