Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLU Peptide - C-terminal region

CLU Peptide - C-terminal region

Product Specifications

Product Name Alternative

AAG4, APOJ, CLI, KUB1, MGC24903, SGP-2, SGP2, SP-40, TRPM-2, TRPM2, APO-J, NA1/NA2

UniProt

P10909

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLU Rabbit Polyclonal Antibody (orb584908) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001822

Preservative

Lyophilized powder

AA Sequence

CREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kylt® MRS FS 25
31008 each

Kylt® MRS FS 25

Sign In for Pricing
View Details
Human HAP1 (Huntingtin Associated Protein 1) ELISA Kit
EK243949 96 Well

Human HAP1 (Huntingtin Associated Protein 1) ELISA Kit

Sign In for Pricing
View Details
Mouse MAP kinase-activating death domain protein (MADD) ELISA Kit
EK9980 48 Tests

Mouse MAP kinase-activating death domain protein (MADD) ELISA Kit

Sign In for Pricing
View Details
RFX6 shRNA (h) Lentiviral Particles
sc-95649-V 200 µL

RFX6 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Histone H3 Colorimetric Cell-Based ELISA Kit
MBS9500289-01 1 Kit

Histone H3 Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Histone H3 Colorimetric Cell-Based ELISA Kit
MBS9500289-02 5x 1 Kit

Histone H3 Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details