Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLUAP1 Peptide - C-terminal region

CLUAP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ13297, KIAA0643, FAP22

UniProt

Q96AJ1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLUAP1 Rabbit Polyclonal Antibody (orb582653) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055856

Preservative

Lyophilized powder

AA Sequence

RIVGTMQGGDSDDNEDSEESEIDMEDDDDEDDDLEDESISLSPTKPNRRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neutrophil Elastase (ELANE) (NM_001972) Human Over-expression Lysate
LY419618 100 µg

Neutrophil Elastase (ELANE) (NM_001972) Human Over-expression Lysate

Sign In for Pricing
View Details
2-Chloro-1,3,2-dioxaphospholane-2-oxide
TRC-C365755-25G 25 g

2-Chloro-1,3,2-dioxaphospholane-2-oxide

Sign In for Pricing
View Details
TRIM39-RPP21 (NM_001199119) Human Over-expression Lysate
LC434279 20 µg

TRIM39-RPP21 (NM_001199119) Human Over-expression Lysate

Sign In for Pricing
View Details
FGFBP1 Antibody
KC-2150-01 50 μL

FGFBP1 Antibody

Sign In for Pricing
View Details
FGFBP1 Antibody
KC-2150-02 100 µL

FGFBP1 Antibody

Sign In for Pricing
View Details
FGFBP1 Antibody
KC-2150-03 1 mL

FGFBP1 Antibody

Sign In for Pricing
View Details