Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLUAP1 Peptide - C-terminal region

CLUAP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ13297, KIAA0643, FAP22

UniProt

Q96AJ1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLUAP1 Rabbit Polyclonal Antibody (orb582653) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055856

Preservative

Lyophilized powder

AA Sequence

RIVGTMQGGDSDDNEDSEESEIDMEDDDDEDDDLEDESISLSPTKPNRRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MS4A7 (NM_206939) Human Recombinant Protein
TP312066M 100 µg

MS4A7 (NM_206939) Human Recombinant Protein

Sign In for Pricing
View Details
CD35 / CR1 (CR1/802), CF740 conjugate, 0.1mg/mL
BNC740802-100 1x 100 µL

CD35 / CR1 (CR1/802), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ASPDH (NM_001024656) Human Over-expression Lysate
LY422526 100 µg

ASPDH (NM_001024656) Human Over-expression Lysate

Sign In for Pricing
View Details
ABAT (NM_000663) Human Recombinant Protein
TP306793 20 µg

ABAT (NM_000663) Human Recombinant Protein

Sign In for Pricing
View Details
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2602), 0.2mg/mL
BNUB2602-100 1x 100 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2602), 0.2mg/mL

Sign In for Pricing
View Details
Yeats4 Mouse Gene Knockout Kit (CRISPR)
KN519545 1 Kit

Yeats4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details