Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLUL1 Peptide - middle region

CLUL1 Peptide - middle region

Product Specifications

Product Name Alternative

RA337M

UniProt

Q15846

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLUL1 Rabbit Polyclonal Antibody (orb582604) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055225

Preservative

Lyophilized powder

AA Sequence

TEIIFNSIQVVPRIHEGNISKQDETMMTDLSILPSSNFTLKIPLEESAES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat RHO (Rhodopsin) ELISA Kit
ELK7622-01 48 Tests

Rat RHO (Rhodopsin) ELISA Kit

Sign In for Pricing
View Details
Rat RHO (Rhodopsin) ELISA Kit
ELK7622-02 96 Tests

Rat RHO (Rhodopsin) ELISA Kit

Sign In for Pricing
View Details
Rat RHO (Rhodopsin) ELISA Kit
ELK7622-03 5x 96 Tests

Rat RHO (Rhodopsin) ELISA Kit

Sign In for Pricing
View Details
NF kappaB p105/p50 Antibody
AF6217-01 100 µL

NF kappaB p105/p50 Antibody

Sign In for Pricing
View Details
NF kappaB p105/p50 Antibody
AF6217-02 200 µL

NF kappaB p105/p50 Antibody

Sign In for Pricing
View Details
Hsa-miR-6069 miRNA Agomir
orb1919613-01 5 nmol

Hsa-miR-6069 miRNA Agomir

Sign In for Pricing
View Details