Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLUL1 Peptide - middle region

CLUL1 Peptide - middle region

Product Specifications

Product Name Alternative

RA337M

UniProt

Q15846

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLUL1 Rabbit Polyclonal Antibody (orb582604) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055225

Preservative

Lyophilized powder

AA Sequence

TEIIFNSIQVVPRIHEGNISKQDETMMTDLSILPSSNFTLKIPLEESAES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYST1 Adenovirus (Mouse)
31340054 750 µL

MYST1 Adenovirus (Mouse)

Sign In for Pricing
View Details
CAPRIN1 Rabbit Polyclonal Antibody
E53P08700 100 µL

CAPRIN1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Zfp637 shRNA (UAS) - Lentiviral mouse Zfp637 shRNA (UAS) (100)
GTR15247710 1 Vial

Lentiviral mouse Zfp637 shRNA (UAS) - Lentiviral mouse Zfp637 shRNA (UAS) (100)

Sign In for Pricing
View Details
UCN2 Antibody
E38QA3181 100 µL

UCN2 Antibody

Sign In for Pricing
View Details
Hexylmagnesium bromide solution
sc-235318 100 mL

Hexylmagnesium bromide solution

Sign In for Pricing
View Details
Med29 (NM_026042) Mouse Untagged Clone
MC205837 10 µg

Med29 (NM_026042) Mouse Untagged Clone

Sign In for Pricing
View Details