Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNDP1 Peptide - C-terminal region

CNDP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CN1, CPGL2, HsT2308, MGC102737, MGC10825, MGC142072

UniProt

Q96KN2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CNDP1 Rabbit Polyclonal Antibody (orb584732) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116038

Preservative

Lyophilized powder

AA Sequence

GSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPOP (NM_001007226) Human Over-expression Lysate
LH03632V 100 µg

SPOP (NM_001007226) Human Over-expression Lysate

Sign In for Pricing
View Details
Fmoc-D-Thr (t-Bu) TentaGel® S PHB Resin
SAD1324.25G 25 g

Fmoc-D-Thr (t-Bu) TentaGel® S PHB Resin

Sign In for Pricing
View Details
Rabbit Collagen Alpha 6 (IV) chain (COL4A6) ELISA Kit
GTR10354461 96 Well

Rabbit Collagen Alpha 6 (IV) chain (COL4A6) ELISA Kit

Sign In for Pricing
View Details
Canine ADAMTS-like protein 2 (ADAMTSL2) ELISA Kit
MBS7210923-01 48 Well

Canine ADAMTS-like protein 2 (ADAMTSL2) ELISA Kit

Sign In for Pricing
View Details
Canine ADAMTS-like protein 2 (ADAMTSL2) ELISA Kit
MBS7210923-02 96 Well

Canine ADAMTS-like protein 2 (ADAMTSL2) ELISA Kit

Sign In for Pricing
View Details
Canine ADAMTS-like protein 2 (ADAMTSL2) ELISA Kit
MBS7210923-03 5x 96 Well

Canine ADAMTS-like protein 2 (ADAMTSL2) ELISA Kit

Sign In for Pricing
View Details