Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNDP2 Peptide - middle region

CNDP2 Peptide - middle region

Product Specifications

Product Name Alternative

CN2, CPGL, FLJ10830, HsT2298, PEPA

UniProt

Q96KP4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CNDP2 Rabbit Polyclonal Antibody (orb583472) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060705

Preservative

Lyophilized powder

AA Sequence

ALEAYQKTGQEIPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human RPS6KB2, N-His
MBS1576003-01 0.1 mg

Recombinant Human RPS6KB2, N-His

Sign In for Pricing
View Details
Recombinant Human RPS6KB2, N-His
MBS1576003-02 1 mg

Recombinant Human RPS6KB2, N-His

Sign In for Pricing
View Details
Recombinant Human RPS6KB2, N-His
MBS1576003-03 5x 1 mg

Recombinant Human RPS6KB2, N-His

Sign In for Pricing
View Details
BOD1L Protein Vector (Human) (pPB-His-MBP)
PV327270 500 ng

BOD1L Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
Caspase 3 (CASP3) Magnetic Fluorescence Assay Kit
MBS2155953-01 96 Tests

Caspase 3 (CASP3) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Caspase 3 (CASP3) Magnetic Fluorescence Assay Kit
MBS2155953-02 5x 96 Tests

Caspase 3 (CASP3) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details