CNDP2 Peptide - middle region
CNDP2 Peptide - middle region
Product Specifications
Product Name Alternative
CN2, CPGL, FLJ10830, HsT2298, PEPA
UniProt
Q96KP4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CNDP2 Rabbit Polyclonal Antibody (orb583472) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060705
Preservative
Lyophilized powder
AA Sequence
ALEAYQKTGQEIPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
WYB72458-01 0.5 g
2,2,2-Trifluoroethyl N- (3-methoxypropyl) carbamate
Sign In for Pricing
View Details WYB72458-02 5 g
2,2,2-Trifluoroethyl N- (3-methoxypropyl) carbamate
Sign In for Pricing
View Details 035182-HRP 200 µL
ERBB2, phosphorylated (Y1139) (ERBB2, HER2, MLN19, NEU, NGL, Receptor tyrosine-protein kinase erbB-2, Metastatic lymph node gene 19 protein, Proto-oncogene Neu, Proto-oncogene c-ErbB-2, Tyrosine kinase-type cell surface receptor HER2, p185erbB2, CD340) (Azide free) (HRP) discontinued
Sign In for Pricing
View Details