CNIH1 Peptide - N-terminal region
CNIH1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
Cnih
UniProt
B0BNA6
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CNIH1 Rabbit Polyclonal Antibody (orb579838) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001099499
Preservative
Lyophilized powder
AA Sequence
AFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470181-500 1x 500 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470669-500 1x 500 µL
P27 / KIP1 (SX53G8), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040525-100 1x 100 µL
CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401274-500 1x 500 µL
Cytokeratin 10 (Suprabasal Epithelial Marker) (AE20), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470159-100 1x 100 µL
Mucin 1 / EMA / Episialin / CD227 (GP1.4), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details