Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNN3 Peptide - C-terminal region

CNN3 Peptide - C-terminal region

Product Specifications

UniProt

Q15417

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CNN3 Rabbit Polyclonal Antibody (orb331078) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001830

Preservative

Lyophilized powder

AA Sequence

NGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stability Test Chamber BTST-1615
BTST-1615 1 Unit

Stability Test Chamber BTST-1615

Sign In for Pricing
View Details
ATG5 (Autophagy Marker) (ATG5/2553), 0.2mg/mL
BNUB2553-100 1x 100 µL

ATG5 (Autophagy Marker) (ATG5/2553), 0.2mg/mL

Sign In for Pricing
View Details
Involucrin (IVRN/827), 0.2mg/mL
BNUB0827-500 1x 500 µL

Involucrin (IVRN/827), 0.2mg/mL

Sign In for Pricing
View Details
Txn2 (NM_019913) Mouse Tagged ORF Clone
MG201355 10 µg

Txn2 (NM_019913) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
GloMeltTM Thermal Shift Protein Stability Kit
#33021-1 1 Kit

GloMeltTM Thermal Shift Protein Stability Kit

Sign In for Pricing
View Details
4-Tolylsulfonamide
TRC-T536630-1G 1 g

4-Tolylsulfonamide

Sign In for Pricing
View Details