Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNN3 Peptide - C-terminal region

CNN3 Peptide - C-terminal region

Product Specifications

UniProt

Q15417

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CNN3 Rabbit Polyclonal Antibody (orb331078) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001830

Preservative

Lyophilized powder

AA Sequence

NGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rozanolixizumab Biosimilar - Research Grade
ICH5051-10mg 10 mg (2x 5 mg)

Rozanolixizumab Biosimilar - Research Grade

Sign In for Pricing
View Details
MCU Mouse Monoclonal Antibody [A2E11]
EM1901-85 100 µL

MCU Mouse Monoclonal Antibody [A2E11]

Sign In for Pricing
View Details
p53 (TP53) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7A11]
TA805505BM 100 µL

p53 (TP53) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7A11]

Sign In for Pricing
View Details
MEK3 (MAP2K3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B2]
TA505868AM 100 µL

MEK3 (MAP2K3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B2]

Sign In for Pricing
View Details
Fam240b Mouse Gene Knockout Kit (CRISPR)
KN500035 1 Kit

Fam240b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), Biotin conjugate, 0.1mg/mL
BNCB2984-500 1x 500 µL

Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details