Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cnot3 Peptide - N-terminal region

Cnot3 Peptide - N-terminal region

Product Specifications

UniProt

D3ZXE8

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cnot3 Rabbit Polyclonal Antibody (orb576960) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001100941

Preservative

Lyophilized powder

AA Sequence

VSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRDQIKTWVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Hydroxy Bromazepam-d4
TRC-H830032-1MG 1 mg

3-Hydroxy Bromazepam-d4

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS505034 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
Glucokinase (GCK) Rabbit Monoclonal Antibody
TA423482 100 µL

Glucokinase (GCK) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human MAP7D2 activation kit by CRISPRa
GA116872 1 Kit

Human MAP7D2 activation kit by CRISPRa

Sign In for Pricing
View Details
Bard1 Mouse Gene Knockout Kit (CRISPR)
KN501977 1 Kit

Bard1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ddx24 Mouse Monoclonal Antibody [A3B10]
EM1902-03 100 µL

ddx24 Mouse Monoclonal Antibody [A3B10]

Sign In for Pricing
View Details