Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cnot3 Peptide - N-terminal region

Cnot3 Peptide - N-terminal region

Product Specifications

UniProt

D3ZXE8

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cnot3 Rabbit Polyclonal Antibody (orb576960) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001100941

Preservative

Lyophilized powder

AA Sequence

VSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRDQIKTWVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytisus sscoparius Gel -CSA- Immobilized Lectin
A-3201-2 2 mL

Cytisus sscoparius Gel -CSA- Immobilized Lectin

Sign In for Pricing
View Details
MCL1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10C5]
TA500989AM 100 µL

MCL1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10C5]

Sign In for Pricing
View Details
2-Benzotriazolyl-4-tert-octylphenol
TRC-B207010-2.5G 2.5 g

2-Benzotriazolyl-4-tert-octylphenol

Sign In for Pricing
View Details
Rat Sex Hormone Binding Globulin (SHBG) ELISA Kit
RD-SHBG-Ra-01 96 Tests

Rat Sex Hormone Binding Globulin (SHBG) ELISA Kit

Sign In for Pricing
View Details
Rat Sex Hormone Binding Globulin (SHBG) ELISA Kit
RD-SHBG-Ra-02 48 Tests

Rat Sex Hormone Binding Globulin (SHBG) ELISA Kit

Sign In for Pricing
View Details
MIR99AHG (NM_001005733) Human Over-expression Lysate
LC423636 20 µg

MIR99AHG (NM_001005733) Human Over-expression Lysate

Sign In for Pricing
View Details