Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNOT7 Peptide - middle region

CNOT7 Peptide - middle region

Product Specifications

Product Name Alternative

CAF1, hCAF-1

UniProt

Q9UIV1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CNOT7 Rabbit Polyclonal Antibody (orb574288) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037486

Preservative

Lyophilized powder

AA Sequence

LDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human S100P/S100E Protein
PKSH030800 100 µg

Recombinant Human S100P/S100E Protein

Sign In for Pricing
View Details
Clca4a Mouse Gene Knockout Kit (CRISPR)
KN503388 1 Kit

Clca4a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3-Aminopropyl-24,25-dihydroxy Vitamin D3
TRC-A628330-5MG 5 mg

3-Aminopropyl-24,25-dihydroxy Vitamin D3

Sign In for Pricing
View Details
Septin 2 (SEPT2) (NM_006155) Human Recombinant Protein
TP311473M 100 µg

Septin 2 (SEPT2) (NM_006155) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS800953 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Recombinant VEGFA Antibody
RC-5476-01 50 μL

Recombinant VEGFA Antibody

Sign In for Pricing
View Details