Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNOT7 Peptide - middle region

CNOT7 Peptide - middle region

Product Specifications

Product Name Alternative

CAF1, hCAF-1

UniProt

Q9UIV1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CNOT7 Rabbit Polyclonal Antibody (orb574288) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037486

Preservative

Lyophilized powder

AA Sequence

LDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclophilin F (PPIF) Mouse Monoclonal Antibody [Clone ID: OTI1C4]
CF809029 100 µg

Cyclophilin F (PPIF) Mouse Monoclonal Antibody [Clone ID: OTI1C4]

Sign In for Pricing
View Details
AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2491), CF488A conjugate, 0.1mg/mL
BNC882491-100 1x 100 µL

AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2491), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Ileum
CS803308 5x 5 µm

Tissue FFPE Sections, Ileum

Sign In for Pricing
View Details
VEGF Receptor 2 (KDR) (esKDR) Rabbit Polyclonal Antibody
AP26034PU-L 200 µg

VEGF Receptor 2 (KDR) (esKDR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Histone H4 (acetyl K16) Recombinant Rabbit Monoclonal Antibody [JB21-44]
ET7107-89 100 µL

Histone H4 (acetyl K16) Recombinant Rabbit Monoclonal Antibody [JB21-44]

Sign In for Pricing
View Details
Tissue Total RNA, Cervix
CR562319 5 µg

Tissue Total RNA, Cervix

Sign In for Pricing
View Details