Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR2 Peptide - C-terminal region

CNR2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CB2, CX5

UniProt

P34972

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CNR2 Rabbit Polyclonal Antibody (orb585665) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001832

Preservative

Lyophilized powder

AA Sequence

MVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C2orf44 Rabbit pAb, BF700 conjugated
orb2838380 100 µL

C2orf44 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
R-138727
HY-123669 1 Each

R-138727

Sign In for Pricing
View Details
IL3RA Rabbit Polyclonal Antibody (FITC)
orb2093271 100 µL

IL3RA Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
HOXA2 Antibody
A25446-100UG 100 µg

HOXA2 Antibody

Sign In for Pricing
View Details
EGFR domain III Recombinant Antibody [h-R3 (Nimotuzumab) ]
OAAV01168-200UG 200 µg

EGFR domain III Recombinant Antibody [h-R3 (Nimotuzumab) ]

Sign In for Pricing
View Details
Human Cervical Microvascular Endothelial Cells
ARP0005 0.5 Million

Human Cervical Microvascular Endothelial Cells

Sign In for Pricing
View Details