Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR2 Peptide - C-terminal region

CNR2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CB2, CX5

UniProt

P34972

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CNR2 Rabbit Polyclonal Antibody (orb585665) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001832

Preservative

Lyophilized powder

AA Sequence

MVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GIMAP8 (NM_175571) Human Over-expression Lysate
LS155038 100 µg

GIMAP8 (NM_175571) Human Over-expression Lysate

Sign In for Pricing
View Details
NFkB p65 Antibody (Ser529)
MBS5313643-01 0.1 mg

NFkB p65 Antibody (Ser529)

Sign In for Pricing
View Details
NFkB p65 Antibody (Ser529)
MBS5313643-02 5x 0.1 mg

NFkB p65 Antibody (Ser529)

Sign In for Pricing
View Details
ADCY6 Rabbit Polyclonal Antibody (Cy5)
orb897610 100 µL

ADCY6 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Anti-PDZD8 Antibody Picoband®
A10427-1 100 µg/Vial

Anti-PDZD8 Antibody Picoband®

Sign In for Pricing
View Details
NCKAP1L Polyclonal Antibody, APC Conjugated
bs-12345R-APC 100 µL

NCKAP1L Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details