Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNTD1 Peptide - N-terminal region

CNTD1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CNTD, FLJ40137

UniProt

Q8N815

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CNTD1 Rabbit Polyclonal Antibody (orb325841) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775749

Preservative

Lyophilized powder

AA Sequence

QNEQAVREASGRLGRFREPQIVEFVFLLSEQWCLEKSVSYQAVEILERFM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Fastk shRNA (UAS) - Lentiviral mouse Fastk shRNA (UAS) (100)
GTR15269682 1 Vial

Lentiviral mouse Fastk shRNA (UAS) - Lentiviral mouse Fastk shRNA (UAS) (100)

Sign In for Pricing
View Details
Phosphocreatine
sc-477537B 100 g

Phosphocreatine

Sign In for Pricing
View Details
Animal-Free IFN-lambda 3/IL-28B, Mouse (His)
HY-P700204AF-01 2 µg

Animal-Free IFN-lambda 3/IL-28B, Mouse (His)

Sign In for Pricing
View Details
Animal-Free IFN-lambda 3/IL-28B, Mouse (His)
HY-P700204AF-02 10 µg

Animal-Free IFN-lambda 3/IL-28B, Mouse (His)

Sign In for Pricing
View Details
Animal-Free IFN-lambda 3/IL-28B, Mouse (His)
HY-P700204AF-03 50 µg

Animal-Free IFN-lambda 3/IL-28B, Mouse (His)

Sign In for Pricing
View Details
Calcr siRNA Oligos set (Rat)
14926176 3x 5 nmol

Calcr siRNA Oligos set (Rat)

Sign In for Pricing
View Details