Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNTN1 Peptide - middle region

CNTN1 Peptide - middle region

Product Specifications

Product Name Alternative

F3, GP135

UniProt

Q12860

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001834

Preservative

Lyophilized powder

AA Sequence

QLEDEGIYECEAENIRGKDKHQARIYVQAFPEWVEHINDTEVDIGSDLYW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAGE4 Antibody
CSB-PA265405 100 µL

BAGE4 Antibody

Sign In for Pricing
View Details
FRS2 Antibody
KC-27623-01 50 μL

FRS2 Antibody

Sign In for Pricing
View Details
FRS2 Antibody
KC-27623-02 100 µL

FRS2 Antibody

Sign In for Pricing
View Details
FRS2 Antibody
KC-27623-03 1 mL

FRS2 Antibody

Sign In for Pricing
View Details
Human MED30 Knockout A549 cell line
GTR15402548 1 Vial

Human MED30 Knockout A549 cell line

Sign In for Pricing
View Details
Recombinant Pasteurella Multocida PM0630 Protein (aa 
21-159)
VAng-Cr7097-500gEcoli 500 µg (E. coli)

Recombinant Pasteurella Multocida PM0630 Protein (aa 21-159)

Sign In for Pricing
View Details