Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COCH Peptide - C-terminal region

COCH Peptide - C-terminal region

Product Specifications

Product Name Alternative

COCH-5B2, COCH5B2, DFNA9

UniProt

O43405

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COCH Rabbit Polyclonal Antibody (orb584385) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001128530

Preservative

Lyophilized powder

AA Sequence

VAWAPLDDLKDMASKPKESHAFFTREFTGLEPIVSDVIRGICRDFLESQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ggnbp1 activation kit by CRISPRa
GA208615 1 Kit

Mouse Ggnbp1 activation kit by CRISPRa

Sign In for Pricing
View Details
RGS9 (NM_001081955) Human Over-expression Lysate
LY421179 100 µg

RGS9 (NM_001081955) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human ULBP1/N2DL1 Protein (His Tag)
PKSH031492 100 µg

Recombinant Human ULBP1/N2DL1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Fas/CD95/TNFRSF6 Protein (His Tag)
PKSH031750 100 µg

Recombinant Human Fas/CD95/TNFRSF6 Protein (His Tag)

Sign In for Pricing
View Details
PPP3R1 Antibody
OC-2429-01 50 μL

PPP3R1 Antibody

Sign In for Pricing
View Details
PPP3R1 Antibody
OC-2429-02 100 µL

PPP3R1 Antibody

Sign In for Pricing
View Details