Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL4A3 Peptide - N-terminal region

COL4A3 Peptide - N-terminal region

Product Specifications

UniProt

E7ENN2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COL4A3 Rabbit Polyclonal Antibody (orb584543) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112730

Preservative

Lyophilized powder

AA Sequence

PPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome C (CYCS/1010), CF647 conjugate, 0.1mg/mL
BNC471010-500 1x 500 µL

Cytochrome C (CYCS/1010), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD269 / TNFRSF17 / BCMA (B-Cell Maturation Protein) (BCMA/2366), CF594 conjugate, 0.1mg/mL
BNC942366-500 1x 500 µL

CD269 / TNFRSF17 / BCMA (B-Cell Maturation Protein) (BCMA/2366), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vps41 Mouse Gene Knockout Kit (CRISPR)
KN519260 1 Kit

Vps41 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RNF4 Rabbit Polyclonal Antibody
TA380998 100 µL

RNF4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Brequinar Sodium
TRC-B677455-5MG 5 mg

Brequinar Sodium

Sign In for Pricing
View Details
Zomepirac Sodium Salt
TRC-Z675000-100MG 100 mg

Zomepirac Sodium Salt

Sign In for Pricing
View Details