Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL4A3 Peptide - N-terminal region

COL4A3 Peptide - N-terminal region

Product Specifications

UniProt

E7ENN2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COL4A3 Rabbit Polyclonal Antibody (orb584543) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112730

Preservative

Lyophilized powder

AA Sequence

PPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ETS1 (Marker of Tumor Metastasis) (ETS1/1801), CF640R conjugate, 0.1mg/mL
BNC401801-500 1x 500 µL

ETS1 (Marker of Tumor Metastasis) (ETS1/1801), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD38 Recombinant Rabbit monoclonal Antibody
IRS006 100 µL

CD38 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human Emi1 (FBXO5) activation kit by CRISPRa
GA108834 1 Kit

Human Emi1 (FBXO5) activation kit by CRISPRa

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2037), CF640R conjugate, 0.1mg/mL
BNC402037-500 1x 500 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2037), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human FAM222B activation kit by CRISPRa
GA110919 1 Kit

Human FAM222B activation kit by CRISPRa

Sign In for Pricing
View Details
2-Bromotriphenylene
TRC-B415970-50MG 50 mg

2-Bromotriphenylene

Sign In for Pricing
View Details