Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL8A2 Peptide - middle region

COL8A2 Peptide - middle region

Product Specifications

Product Name Alternative

FECD, FECD1, FLJ00201, MGC116970, MGC116972, PPCD, PPCD2

UniProt

P25067

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COL8A2 Rabbit Polyclonal Antibody (orb326324) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005193

Preservative

Lyophilized powder

AA Sequence

AAGLPGPQGPSGAKGEPGTRGPPGLIGPTGYGMPGLPGPKGDRGPAGVPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ATG7 (Autophagy-related protein 7) ELISA Kit
MBS7607049-01 48 Well

Human ATG7 (Autophagy-related protein 7) ELISA Kit

Sign In for Pricing
View Details
Human ATG7 (Autophagy-related protein 7) ELISA Kit
MBS7607049-02 96 Well

Human ATG7 (Autophagy-related protein 7) ELISA Kit

Sign In for Pricing
View Details
Human ATG7 (Autophagy-related protein 7) ELISA Kit
MBS7607049-03 5x 96 Well

Human ATG7 (Autophagy-related protein 7) ELISA Kit

Sign In for Pricing
View Details
Human ATG7 (Autophagy-related protein 7) ELISA Kit
MBS7607049-04 10x 96 Well

Human ATG7 (Autophagy-related protein 7) ELISA Kit

Sign In for Pricing
View Details
Human RPL8 Pre-designed siRNA Set B
SI014016B 1 Each

Human RPL8 Pre-designed siRNA Set B

Sign In for Pricing
View Details
GAGE5 Human siRNA Oligo Duplex (Locus ID 2577)
SR301716 1 Kit

GAGE5 Human siRNA Oligo Duplex (Locus ID 2577)

Sign In for Pricing
View Details