Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL9A3 Peptide - C-terminal region

COL9A3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DJ885L7.4.1, EDM3, FLJ90759, IDD, MED

UniProt

Q14050

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COL9A3 Rabbit Polyclonal Antibody (orb584547) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001844

Preservative

Lyophilized powder

AA Sequence

PGMPANQDTIYEGIGGPRGEKGQKGEPAIIEPGMLIEGPPGPEGPAGLPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rochelle’s Salt
TRC-R639470-50G 50 g

Rochelle’s Salt

Sign In for Pricing
View Details
Cytokeratin, pan (Epithelial Marker) (PCK/3150), CF568 conjugate, 0.1mg/mL
BNC683150-100 1x 100 µL

Cytokeratin, pan (Epithelial Marker) (PCK/3150), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PNPO Antibody
KC-28408-01 50 μL

PNPO Antibody

Sign In for Pricing
View Details
PNPO Antibody
KC-28408-02 100 µL

PNPO Antibody

Sign In for Pricing
View Details
PNPO Antibody
KC-28408-03 1 mL

PNPO Antibody

Sign In for Pricing
View Details
Beta III Tubulin Mouse monoclonal Antibody
HA600133F 100 µL

Beta III Tubulin Mouse monoclonal Antibody

Sign In for Pricing
View Details