COL9A3 Peptide - C-terminal region
COL9A3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
DJ885L7.4.1, EDM3, FLJ90759, IDD, MED
UniProt
Q14050
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with COL9A3 Rabbit Polyclonal Antibody (orb584547) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001844
Preservative
Lyophilized powder
AA Sequence
PGMPANQDTIYEGIGGPRGEKGQKGEPAIIEPGMLIEGPPGPEGPAGLPG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-B211001-2G 2 g
Benzyl 2-Acetamido-4,6-O-Benzylidene-2-Deoxy-Beta-D-Glucopyranoside
Sign In for Pricing
View Details 
PKSH030490 200 µg
Recombinant Human FGFR3/CD333 Protein (alpha (IIIb), Fc Tag)
Sign In for Pricing
View Details 
KN420336 1 Kit
Liprin alpha 2 (PPFIA2) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details 
TP310752M 100 µg
Tartrate Resistant Acid Phosphatase (ACP5) (NM_001611) Human Recombinant Protein
Sign In for Pricing
View Details 