COLQ Peptide - C-terminal region
COLQ Peptide - C-terminal region
Product Specifications
Product Name Alternative
EAD, FLJ55041
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with COLQ Rabbit Polyclonal Antibody (orb575265) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_536805
Preservative
Lyophilized powder
AA Sequence
GKPGPSGQPGRPGPPGPPPAGHMETCNAPSTATSTPRPAATSPEGREEKV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Alpha B Crystallin (CRYAB) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6A9]](https://cdn.genprice.uk/products/937/6868c319994c49e6dc3eebc8/imageurl/ta500581bm.webp)
TA500581BM 100 µL
Alpha B Crystallin (CRYAB) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6A9]
Sign In for Pricing
View Details 
16050-AAT 1 mg
ROS Brite™ APF *Optimized for Detecting Reactive Oxygen Species (ROS) *
Sign In for Pricing
View Details 
![NLRX1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H8]](https://cdn.genprice.uk/products/937/68dd1b82061270361ea1f118/imageurl/ta809764am.webp)
TA809764AM 100 µL
NLRX1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H8]
Sign In for Pricing
View Details